PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_17848
Common NameKK1_018374
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 514aa    MW: 55980.8 Da    PI: 4.7339
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_17848genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.43.4e-184390148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed++lvd+vk++G g+W+++ ++ g+ R++k+c++rw ++l
    C.cajan_17848 43 KGPWTSTEDDILVDYVKKHGEGNWNAVQKHTGLLRCGKSCRLRWANHL 90
                     79******************************99**********9986 PP

2Myb_DNA-binding25.82.5e-0896126132
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmg 32 
                      +g++T+eE+ l++++++++G++ W++ a++++
    C.cajan_17848  96 KGAFTAEEERLIAELHAKMGNK-WARMAAHLP 126
                      799*******************.********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.1763894IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.3E-234193IPR009057Homeodomain-like
SMARTSM007178.4E-154292IPR001005SANT/Myb domain
PfamPF002493.5E-164390IPR001005SANT/Myb domain
SuperFamilySSF466891.68E-2444120IPR009057Homeodomain-like
CDDcd001671.12E-114590No hitNo description
PROSITE profilePS500906.56291126IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.607.3E-1494126IPR009057Homeodomain-like
SMARTSM007170.005895165IPR001005SANT/Myb domain
PfamPF002492.4E-796126IPR001005SANT/Myb domain
CDDcd001676.54E-498126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 514 aa     Download sequence    Send to blast
MRRLKNDINE DEVLPNDQTG AQLNGAQLND EGSEGSAGVV LKKGPWTSTE DDILVDYVKK  60
HGEGNWNAVQ KHTGLLRCGK SCRLRWANHL RPNLKKGAFT AEEERLIAEL HAKMGNKWAR  120
MAAHLPESQH SQSSGGLNGD NKMHPDFLQK NSYEIQDSIF DSLKDNQGII PYMPELSDIS  180
VYGNMLKGFD SSQYCSFVPP TSPKHKRLRE STIPFIDSSD MSRNGLYPFD QIRDNNSDEI  240
AQSFGMPAPL DPGPSSHSSI CYSHSLSNGN SSTSKPTYEA VKLELPSLQY PELDLGSWGT  300
SPPPSLLESV DDFIQSPTPI STLESDCSSP QNSGLLDALL YQARTLSSSK NHCSDKSSNS  360
STATPGDRAD SSALNVHETE WEDYADPVSP FGATSILNEC PALNANANSL DKQLPVQTFN  420
GDILKLESVD EVWTPNGENQ TLSLLNITRP DFLLASDWHD LSSGHGKNLA FTTDATTTLG  480
LGDDLATDHK HVTAGTSKSS QMWGFGSCAT AMIG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-2141126589B-MYB
1h8a_C2e-214112625109MYB TRANSFORMING PROTEIN
1mse_C1e-2140126186C-Myb DNA-Binding Domain
1msf_C1e-2140126186C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU3283980.0EU328398.1 Glycine max GAMYB protein (GAMYB) mRNA, complete cds.
GenBankKC5258970.0KC525897.1 Glycine max GAMBY1-like family protein (GAMYB1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001304541.10.0transcription factor GAMYB-like
TrEMBLA0A151T9R60.0A0A151T9R6_CAJCA; Transcription factor GAMYB
STRINGGLYMA13G25716.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.32e-79myb domain protein 33